PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538989.1_FGP014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 992aa    MW: 108888 Da    PI: 4.894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538989.1_FGP014genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-185096148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  KN538989.1_FGP014 50 KGNWTPEEDAILSRAVQTYNGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                       79******************************.************986 PP

2Myb_DNA-binding62.39.6e-20102148148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+W++eEde++v+ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  KN538989.1_FGP014 102 KGPWSKEEDEIIVQMVNKLGPKKWSTIAQALP-GRIGKQCRERWYNHL 148
                        79******************************.*************97 PP

3Myb_DNA-binding48.52e-15154196145
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        + +WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  KN538989.1_FGP014 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 196
                        579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3834596IPR017930Myb domain
SuperFamilySSF466893.31E-1646102IPR009057Homeodomain-like
SMARTSM007175.1E-174998IPR001005SANT/Myb domain
PfamPF002492.3E-165096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2452113IPR009057Homeodomain-like
CDDcd001671.26E-145296No hitNo description
PROSITE profilePS5129431.18397152IPR017930Myb domain
SuperFamilySSF466899.35E-3199195IPR009057Homeodomain-like
SMARTSM007173.2E-18101150IPR001005SANT/Myb domain
PfamPF002491.2E-17102148IPR001005SANT/Myb domain
CDDcd001676.02E-16104148No hitNo description
Gene3DG3DSA:1.10.10.601.8E-25114155IPR009057Homeodomain-like
SMARTSM007172.2E-14153201IPR001005SANT/Myb domain
PROSITE profilePS5129419.815153203IPR017930Myb domain
PfamPF002496.5E-14154197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-21156203IPR009057Homeodomain-like
CDDcd001674.14E-11156196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 992 aa     Download sequence    Send to blast
MESLLDLRRL LKKEKSAMNQ KGDDLSMGKR LKALLTIVMR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYNG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKL  120
GPKKWSTIAQ ALPGRIGKQC RERWYNHLNP GINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNS IKNHWNSSVK KKVNSYMSSG LLTQVSCLPL NEYSANCNSS PAMAQQNSED  240
SGCFAVREVE NSSGCSQSSL AKVSCSQVHD TTVPLGCDLQ VNVNFDKNEA HDSQSSMGPQ  300
ACYTSAEAVA SALPAVHCHV SSSNLDPDQH LQEDFAQGLN LDMTIDEMPT VPSFADNQTV  360
CSIENHERSL EPYDVAMEVP LSMLSSDSGA EQKLHFMSEA DFNSPNCLKS ELWQDISLQG  420
LLSGPDAVEA DSFSRSNHQS DVYSSEADTH FLAPPYMPQT SNSSSVMGLA DDQSPQMSVP  480
PSLICSNAMT DDAPFDNRPG QKEMPLSQAE VVTQSSSSSG DAEMFANPGC SNDRHVPSST  540
MESIPECGDQ QVTNVEEPEA SLEKEPSLTQ SVTAPDEQDK GALFYEPPRF PSLDVPFVSC  600
DLVTSGDLQE FSPLGIRQLM HSTMNVCTPM RLWGSPTHDE STGVLLKSAA KSFICTPSIL  660
KKRHRDLLSP IPDKRIEKKY GTEKDRGVSD TSSTGIQTSC INATKDDALI TTVLRIERSA  720
SSKSLEKKLV FSDENKENLG YTTEQTKDGQ SAGNDEHMDE QTTGERSSAT NVATNDDLSG  780
NLQPAGILIE HSGDDPISPD YGKNTMNQKL NTNVKSLSVC KEGVCAKSKP TELIVEKSSP  840
CINVDYEYVN ILADTPGIKR GLESPSAWKS PWFVDMHFQG SYFTSPTDSY DALGLMKQIN  900
VQTAAALVEA REVLASGGQC DNISSDKENT GNPDAKKEPG TTKLQTKIMA EGRVLDFECT  960
TPVRSSDKNA GSNLGRYLSS PIPSSHLLKS FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C4e-66502036159MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-66502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3186010.0AK318601.1 Oryza sativa Japonica Group cDNA, clone: J100066E24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625869.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLA0A0D9Y5K10.0A0A0D9Y5K1_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g12860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-134myb domain protein 3r-4